Report pendingGLP-1
A lab-made copy of the natural GLP-1 gut hormone, unchanged, so it breaks down fast.
Report pending
LL-37
A lab-made copy of LL-37, a 37-part peptide from the human cathelicidin family.
Choose a size
mg = milligrams, the amount of powder in the vial.
Buy more, pay less per vial
Earns 325 points (worth $3.25)100 points = $1 off a later order.More with a membership →
- Dry powder in a sealed vial
- Lot number on the label
- Tracked US shipping
- Flat $12 US shipping
$130
Earns 325 points (worth $3.25)
For laboratory research use only. Not for human or animal use. 21+.
Also in the Skin & Collagen Six-Pack Stack: save $108.64. See the stack
Description
About LL-37
A lab-made copy of LL-37, a 37-part peptide from the human cathelicidin family.
LL-37 is a 37-amino-acid peptide, named for its two leading leucines, that is cut from the human cathelicidin protein. It belongs to the antimicrobial peptide family. This is a synthetic copy. Supplied as a lyophilized (freeze-dried) powder for laboratory research.
Research
What scientists have studied, and in what kind of study: lab dish, animal, or human.
Studied for: the cathelicidin peptide family and immune cells [macrophages and neutrophils] (mouse studies).
That describes the research, not what a vial does.
Identity
- Formula
- C205H340N60O53
- Molecular weight
- 4493 g/mol
- Sequence
- H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH
- Sequence length
- 37 amino acids
Sources: PubChem (formula, weight), PubChem (sequence, length)
Report pending
Lab report
Every vial has a lot number. Real reports are being added; for now this shows a sample.
- Lot
- SRT-7577-LL3
- Form
- Lyophilized powder
Specimen — format only, not a measurement.
Storage & handling
Details
Size, form, what's printed on the label, and how to store it.
10 mg375$130
Lyophilized powder · 3mL vial. The label shows the name, size and lot number.
Storage for LL-37 is being confirmed with the supplier. Read the storage guide
For lab research only. This is not a medicine, food, supplement or cosmetic, and it is not for use in people. Sold only to adults 21 and over who are buying it for lab research.
