Report pendingGLP-1
A lab-made copy of the natural GLP-1 gut hormone, unchanged, so it breaks down fast.
Report pending
VIP
A lab-made copy of VIP, a signaling peptide made by nerve cells.
Choose a size
mg = milligrams, the amount of powder in the vial.
Buy more, pay less per vial
Earns 122 points (worth $1.22)100 points = $1 off a later order.More with a membership →
- Dry powder in a sealed vial
- Lot number on the label
- Tracked US shipping
- Flat $12 US shipping
$49
Earns 122 points (worth $1.22)
For laboratory research use only. Not for human or animal use. 21+.
Also in the Gut & Immune Six-Pack Stack: save $100.80. See the stack
Description
About VIP
A lab-made copy of VIP, a signaling peptide made by nerve cells.
Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide ending in an amide, cut from a larger precursor protein. This is a synthetic copy of the natural human sequence. Supplied as a lyophilized (freeze-dried) powder for laboratory research.
Research
What scientists have studied, and in what kind of study: lab dish, animal, or human.
Studied for: VIP receptors [VPAC1 and VPAC2], immune cells, and lung tissue.
That describes the research, not what a vial does.
Identity
- Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- Sequence length
- 28 amino acids
- Accession
- UniProt P01282
No formula is shown: the closest PubChem record (aviptadil) is the free-acid form, and this peptide ends in an amide.
Report pending
Lab report
Every vial has a lot number. Real reports are being added; for now this shows a sample.
- Lot
- SRT-9765-VIP
- Form
- Lyophilized powder
Specimen — format only, not a measurement.
Storage & handling
Details
Size, form, what's printed on the label, and how to store it.
5 mgVIP5$49
10 mgVIP10$75
Lyophilized powder · 3mL vial. The label shows the name, size and lot number.
Storage for VIP is being confirmed with the supplier. Read the storage guide
For lab research only. This is not a medicine, food, supplement or cosmetic, and it is not for use in people. Sold only to adults 21 and over who are buying it for lab research.
