Report pendingGLP-1
A lab-made copy of the natural GLP-1 gut hormone, unchanged, so it breaks down fast.
Report pending
GDF-8 (Myostatin)
A lab-grown copy of myostatin (GDF-8), a signaling protein that acts on the activin type IIB receptor.
Choose a size
mg = milligrams, the amount of powder in the vial.
Buy more, pay less per vial
Earns 520 points (worth $5.20)100 points = $1 off a later order.More with a membership →
- Dry powder in a sealed vial
- Lot number on the label
- Tracked US shipping
- Flat $12 US shipping
$208
Earns 520 points (worth $5.20)
For laboratory research use only. Not for human or animal use. 21+.
Description
About GDF-8 (Myostatin)
A lab-grown copy of myostatin (GDF-8), a signaling protein that acts on the activin type IIB receptor.
GDF-8, also called myostatin, is a member of the TGF-beta family of signaling proteins. This is a recombinant protein; the mature human chain is 109 amino acids long and forms a disulfide-linked pair of chains. Supplied as a lyophilized (freeze-dried) powder for laboratory research.
Research
What scientists have studied, and in what kind of study: lab dish, animal, or human.
Studied for: myostatin itself [GDF-8] and the activin type IIB receptor [ActRIIB].
That describes the research, not what a vial does.
Identity
- Sequence
- DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
- Sequence length
- 109 amino acids
- Accession
- UniProt O14793
GDF-8 is a protein, so it has no small-molecule formula, and UniProt does not state a weight for the mature chain.
Report pending
Lab report
Every vial has a lot number. Real reports are being added; for now this shows a sample.
- Lot
- SRT-3236-GDF
- Form
- Lyophilized powder
Specimen — format only, not a measurement.
Storage & handling
Details
Size, form, what's printed on the label, and how to store it.
1 mgF81$208
Lyophilized powder · 3mL vial. The label shows the name, size and lot number.
Storage for GDF-8 (Myostatin) is being confirmed with the supplier. Read the storage guide
For lab research only. This is not a medicine, food, supplement or cosmetic, and it is not for use in people. Sold only to adults 21 and over who are buying it for lab research.
